Protein Info for Rv2836c in Mycobacterium tuberculosis H37Rv

Annotation: Possible DNA-damage-inducible protein F DinF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 43 to 68 (26 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 273 to 296 (24 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF01554: MatE" amino acids 19 to 178 (160 residues), 98.3 bits, see alignment E=2e-32 amino acids 239 to 393 (155 residues), 57.9 bits, see alignment E=5.1e-20 TIGR00797: MATE efflux family protein" amino acids 19 to 410 (392 residues), 337.2 bits, see alignment E=6.5e-105

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_2851)

Predicted SEED Role

"putative DNA-damage-inducible protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>Rv2836c Possible DNA-damage-inducible protein F DinF (Mycobacterium tuberculosis H37Rv)
LSQVGHRAGGRQIAQLALPALGVLAAEPLYLLFDIAVVGRLGAISLAGLAIGSLVLGLVG
SQATFLSYGTTARAARRYGAGNRVAAVTEGVQATWLALGLGALVVVVVEATATPLVSAIA
SGDGITAAALPWLRIAILGTPAILVSLAGNGWLRGVQDTVRPLRYVVAGFGSSALLCPLL
VYGWLGLPRWGLTGSAVANLVGQWLAALLFAGALLAERVSLRPDRAVLGAQLMMARDLIV
RTLAFQVCYVSAAAVAARFGAAALAAHQVVLQLWGLLALVLDSLAIAAQSLVGAALGAGD
AGHAKAVAWRVTAFSLLAAGILAAALGLGSSVLPGLFTDDRSVLAAIGVPWWFMVVQLPF
AGIVFAVDGVLLGAGDAAFMRTATVASALVGFLPLVWLSLAYGWGLAGIWSGLGTFIVLR
LIFVGWRAYSGRWAVTGAA