Protein Info for Rv2835c in Mycobacterium tuberculosis H37Rv

Annotation: Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 79 to 105 (27 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 302 (208 residues), 75.3 bits, see alignment E=2.6e-25

Best Hits

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to mbt:JTY_2850)

MetaCyc: 32% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter permease subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>Rv2835c Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpA (Mycobacterium tuberculosis H37Rv)
MAAPQRARLRSSKERVRDYALFVVLVGPNVALLLLFVYRPLADNIRLSFFDWNVSDPSAR
FVGLSNYTEWFTRSDTRQIVFNTAVFTGAAVVGSMVLGLALAMLLDRPLRGRNLVRSTVF
APFVISGAAVGLAAQFVFDPHFGLIQDLLRRIGVGVPDFYQDARWALFMVTITYVWKNLG
YTFVIYLAALQGVRRDLLEAAEIDGASRWAVFRRVLLPQLRPTTFFLSITVLINSLQVFD
VINVMTRGGPEGTGTTTMVYQVYVETFRNFRAGYGATVATIMFLVLLAVTYYQVRVMDRG
QRQ