Protein Info for Rv2834c in Mycobacterium tuberculosis H37Rv

Annotation: Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 264 (179 residues), 55.7 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 100% identity to mtf:TBFG_12849)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>Rv2834c Probable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpE (Mycobacterium tuberculosis H37Rv)
VTPDRLRSSVGYAAMLLVVTLIAGPLLFVFFTSFKDQPDIYAQPTSWWPLRWYPQNYRTA
TEQIPFWTFLRNSLIITSVLAVVKFTLGVLSAFGLVFVRFPGRTAVFLVIIAALMVPNQI
TVISNYALISHLGLRNTFAGIILPLAGVAFGTFLMRNHFLSLPAEIIEAARMDGARWWQL
LLRVVLPMSRPTMVAVGVITVVNEWNEYLWPFLMSDDESVAPLPIGLTFLQQAEGVTNWG
PVMAVTLLAMLPILLVFIALQRQMIKGLTSGAVKG