Protein Info for Rv2832c in Mycobacterium tuberculosis H37Rv

Annotation: Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00005: ABC_tran" amino acids 21 to 163 (143 residues), 111.8 bits, see alignment E=4.1e-36 PF17912: OB_MalK" amino acids 237 to 277 (41 residues), 27.8 bits, see alignment 3.9e-10

Best Hits

Swiss-Prot: 54% identical to UGPC3_RHIL3: sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 (ugpC3) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 100% identity to mbb:BCG_2852c)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>Rv2832c Probable Sn-glycerol-3-phosphate transport ATP-binding protein ABC transporter UgpC (Mycobacterium tuberculosis H37Rv)
MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESG
RISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGFALRNAGMSRADTRRRVLEVA
DMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISG
LQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPA
MNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEEL
GFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR