Protein Info for Rv2819c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF03787: RAMPs" amino acids 11 to 266 (256 residues), 38.7 bits, see alignment E=7.9e-14 TIGR01899: CRISPR type III-A/MTUBE-associated RAMP protein Csm5" amino acids 11 to 369 (359 residues), 373.5 bits, see alignment E=7.4e-116

Best Hits

Swiss-Prot: 100% identical to CSM5_MYCTU: CRISPR system Cms protein Csm5 (csm5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2832)

Predicted SEED Role

"CRISPR-associated protein, Csm5 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>Rv2819c Hypothetical protein (Mycobacterium tuberculosis H37Rv)
MNTYLKPFELTLRCLGPVFIGSGEKRTSKEYHVEGDRVYFPDMELLYADIPAHKRKSFEA
FVMNTDGAQATAPLKEWVEPNAVKLDPAKHRGYEVKIGSIEPRRASRGRGGRMTRKKLTL
NEIHAFIKDPLGRPYVPGSTVKGMLRSIYLQSLVHKRTAQPVRVPGHQTREHRQYGERFE
RKELRKSGRPNTRPQDAVNDLFQAIRVTDSPALRTSDLLICQKMDMNVHGKPDGLPLFRE
CLAPGTSISHRVVVDTSPTARGGWREGERFLETLAETAASVNQARYAEYRAMYPGVNAIV
GPIVYLGGGAGYRSKTFVTDQDDMAKVLDAQFGKVVKHVDKTRELRVSPLVLKRTKIDNI
CYEMGQCELSIRRAE