Protein Info for Rv2818c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR02672: CRISPR type III-A/MTUBE-associated protein Csm6" amino acids 22 to 378 (357 residues), 528.4 bits, see alignment E=4.1e-163 PF22208: Cas_Csm6_CARF" amino acids 30 to 137 (108 residues), 154.4 bits, see alignment E=1.2e-49 PF22206: Cas_Csm6_6H" amino acids 141 to 190 (50 residues), 50.1 bits, see alignment 2.6e-17 PF09659: Cas_Csm6_HEPN" amino acids 211 to 373 (163 residues), 90.5 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 100% identical to CSM6_MYCTU: CRISPR system endoribonuclease Csm6 (csm6) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv2818c)

Predicted SEED Role

"CRISPR-associated protein Csm6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>Rv2818c Hypothetical protein (Mycobacterium tuberculosis H37Rv)
VLFLSAEIAAFENADRRYSAAITRLAPETDVRIVTYTNPSVHRFDLFVPVFRNHLVELSA
EFPDRTILLNTSSGTPAMQAALVAINVFGIPRTTAVQVSTPARALSKPGDRESPDAYDLE
LMWDANDDNQPGAPNRCFEATSAALGALLERANLKQLIVSYDYSAAVTIAADSRLPDQVS
NLIRGAMHRSRLEHLVAPKFFKDTAFTYDPANKVAEYISALALLAKREQWAEFARSATPA
ITIVLRAAVAKHLPEDRYLDDMGRVDRRKLEREPEIRCALKHPPKSPNAEWYLYTKDWLA
LLRQFAPDRVGALEVLGRFESRVRNTAAHEIVSISEDRITKDGGLLPEQLLKILARETGA
DLTLYDRLNDEIIRQIDMAPLG