Protein Info for Rv2812 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF13384: HTH_23" amino acids 35 to 81 (47 residues), 29.4 bits, see alignment 1.1e-10 PF13518: HTH_28" amino acids 38 to 86 (49 residues), 46 bits, see alignment 8.8e-16 PF00665: rve" amino acids 159 to 256 (98 residues), 68.1 bits, see alignment E=1.4e-22 PF09299: Mu-transpos_C" amino acids 340 to 389 (50 residues), 39.2 bits, see alignment 1.1e-13

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to mbb:BCG_2830)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>Rv2812 Probable transposase (Mycobacterium tuberculosis H37Rv)
VAVGDDEEKVRAERARAIGLFRYQLIWEAADAAHSTKQRGKMVRELASREHTDPFGRRVR
ISRQTIDRWIRGWRAGGFDALVPNPRQCTPRTPAEVLELAVALRRENPQRTAAAIRRILR
TQLGWAPDERTLQRNFHRLGLTGATTGSAPAVFGRFEAEHPNALWTGDVLHGIRIDLRKT
YLFAFLDDHSRLVPGYRWGHAEDTVRLAAALRPALASRGVPNAVYVDNGSPYVDAWLLRA
CAKLGVRLVHSTPGRPQGRGKIERFFRTVREQFLVEITGEPDVVGRHYVADLAELNRLFT
AWVETVYHRSVHSETGQTPLARWSAGGPIPLPAPETLTEAFLWEEHRRVTKTATVSLHGN
RYEIDPALVGRKVELVFDPFDLTRIEVRLAGAPMRRAIPYHIGRHSHPKAKPETPTAPPK
PSGIDYAQLIETAHAAELARGVNYTALTGAADQIPGQLDLLTGQEAQPK