Protein Info for Rv2800 in Mycobacterium tuberculosis H37Rv

Annotation: Possible hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 TIGR00976: hydrolase CocE/NonD family protein" amino acids 45 to 547 (503 residues), 292.7 bits, see alignment E=3.7e-91 PF02129: Peptidase_S15" amino acids 49 to 310 (262 residues), 236.1 bits, see alignment E=5.9e-74 PF08530: PepX_C" amino acids 339 to 541 (203 residues), 89.2 bits, see alignment E=4e-29

Best Hits

KEGG orthology group: K06978, (no description) (inferred from 100% identity to mtu:Rv2800)

Predicted SEED Role

"Possible hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (549 amino acids)

>Rv2800 Possible hydrolase (Mycobacterium tuberculosis H37Rv)
VSTTSARPERPKLRALTGRVGGQALGGLLGLPRATTRYTVGHVRVPMRDGVQLVADHYAP
ATSQPVGTLLVRGPYGRRFPFSLVFARIYAARGYHVVLQSVRGTFGSGGVFEPMVNEAAD
GADTVAWLREQPWFTGRFGTIGLPYLGFTQWALLHDPPPELAAAVITVGPHDFRASVWGT
GSFTVNDFLGWSDLVSHQEDPGRIRAGIRQLTAPRRVARTAATLPLGESARTLLGTGAPW
FESWVEHTDRDDPFWDRLRFPAALDRVQVPVLLVGGWQDIFLRQTLQQYRHLRDRGVHVA
LTVGPWTHTQMLTKGLATGARESLDWLDAHLGRAPALRPSPVRVFVTGQGWRHLPDWPPA
TTERAWYLQPGGRLGESAPASGTPPATFRYHPADPTPTTGGPLLSSNGGYRDDSRLATRA
DVLCFTGAPLTHDLCVHGNPVVELVHSSDNPYVDVFVRVSEVDAKGRSRNVSDGYRRLGD
APELVRVELDAIAHRFRADSRIRVLIAGSWFPRYARNLGTPEPILTGRQLKPATHAVHFG
RSRLLLPVG