Protein Info for Rv2794c in Mycobacterium tuberculosis H37Rv

Annotation: Phosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF17837: 4PPT_N" amino acids 36 to 102 (67 residues), 92.3 bits, see alignment E=1.7e-30 PF01648: ACPS" amino acids 110 to 186 (77 residues), 47.6 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 54% identical to PPTAS_NOCIO: 4'-phosphopantetheinyl transferase Npt (npt) from Nocardia iowensis

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2806)

Predicted SEED Role

"4'-phosphopantetheinyl transferase EntD (EC 2.7.8.-)" (EC 2.7.8.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>Rv2794c Phosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase) (Mycobacterium tuberculosis H37Rv)
MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCAR
IALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDV
LPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITF
ETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL