Protein Info for Rv2793c in Mycobacterium tuberculosis H37Rv

Annotation: Probable tRNA pseudouridine synthase B TruB (tRNA pseudouridine 55 synthase) (PSI55 synthase) (pseudouridylate synthase) (uracil hydrolyase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 7 to 218 (212 residues), 235.4 bits, see alignment E=2.6e-74 PF01509: TruB_N" amino acids 27 to 179 (153 residues), 176.3 bits, see alignment E=8e-56 PF16198: TruB_C_2" amino acids 180 to 220 (41 residues), 47 bits, see alignment 3.4e-16 PF09142: TruB_C" amino acids 236 to 291 (56 residues), 81.7 bits, see alignment E=3.6e-27

Best Hits

Swiss-Prot: 100% identical to TRUB_MYCBP: tRNA pseudouridine synthase B (truB) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to mtf:TBFG_12806)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>Rv2793c Probable tRNA pseudouridine synthase B TruB (tRNA pseudouridine 55 synthase) (PSI55 synthase) (pseudouridylate synthase) (uracil hydrolyase) (Mycobacterium tuberculosis H37Rv)
MSATGPGIVVIDKPAGMTSHDVVGRCRRIFATRRVGHAGTLDPMATGVLVIGIERATKIL
GLLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPAKHLTIEAIDAAMERLRGEIRQVPSS
VSAIKVGGRRAYRLARQGRSVQLEARPIRIDRFELLAARRRDQLIDIDVEIDCSSGTYIR
ALARDLGDALGVGGHVTALRRTRVGRFELDQARSLDDLAERPALSLSLDEACLLMFARRD
LTAAEASAAANGRSLPAVGIDGVYAACDADGRVIALLRDEGSRTRSVAVLRPATMHPG