Protein Info for Rv2782c in Mycobacterium tuberculosis H37Rv

Annotation: Probable zinc protease PepR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF00675: Peptidase_M16" amino acids 25 to 171 (147 residues), 126.9 bits, see alignment E=6.2e-41 PF05193: Peptidase_M16_C" amino acids 179 to 354 (176 residues), 144.6 bits, see alignment E=3.2e-46

Best Hits

Swiss-Prot: 100% identical to Y2805_MYCBO: Uncharacterized zinc protease Mb2805c (BQ2027_MB2805C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01422, [EC: 3.4.99.-] (inferred from 100% identity to mtc:MT2852)

Predicted SEED Role

"FIG007959: peptidase, M16 family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>Rv2782c Probable zinc protease PepR (Mycobacterium tuberculosis H37Rv)
MPRRSPADPAAALAPRRTTLPGGLRVVTEFLPAVHSASVGVWVGVGSRDEGATVAGAAHF
LEHLLFKSTPTRSAVDIAQAMDAVGGELNAFTAKEHTCYYAHVLGSDLPLAVDLVADVVL
NGRCAADDVEVERDVVLEEIAMRDDDPEDALADMFLAALFGDHPVGRPVIGSAQSVSVMT
RAQLQSFHLRRYTPERMVVAAAGNVDHDGLVALVREHFGSRLVRGRRPVAPRKGTGRVNG
SPRLTLVSRDAEQTHVSLGIRTPGRGWEHRWALSVLHTALGGGLSSRLFQEVRETRGLAY
SVYSALDLFADSGALSVYAACLPERFADVMRVTADVLESVARDGITEAECGIAKGSLRGG
LVLGLEDSSSRMSRLGRSELNYGKHRSIEHTLRQIEQVTVEEVNAVARHLLSRRYGAAVL
GPHGSKRSLPQQLRAMVG