Protein Info for Rv2773c in Mycobacterium tuberculosis H37Rv

Annotation: Dihydrodipicolinate reductase DapB (DHPR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01113: DapB_N
  • amino acids 1 to 105 (105 residues), 76 bits, E=2.7e-25
• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 42 to 243 (202 residues), 193 bits, E=3.6e-61
• PF05173: DapB_C
  • amino acids 108 to 239 (132 residues), 111.9 bits, E=2.3e-36

Best Hits

Swiss-Prot: 100% identical to DAPB_MYCTU: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 99% identity to mbo:Mb2795c)

MetaCyc: 100% identical to dihydropicolinate reductase subunit (Mycobacterium tuberculosis H37Rv)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (245 amino acids)

>Rv2773c Dihydrodipicolinate reductase DapB (DHPR) (Mycobacterium tuberculosis H37Rv)
MRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMG
NLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAA
RFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGI
PVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEP
LLDLH