Protein Info for Rv2764c in Mycobacterium tuberculosis H37Rv

Annotation: Probable thymidylate synthase ThyA (ts) (TSASE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03284: thymidylate synthase
  • amino acids 3 to 85 (83 residues), 130 bits, E=5e-42
  • amino acids 85 to 263 (179 residues), 299.7 bits, E=1e-93
• PF00303: Thymidylat_synt
  • amino acids 3 to 263 (261 residues), 407.1 bits, E=1.4e-126

Best Hits

Swiss-Prot: 100% identical to TYSY_MYCTU: Thymidylate synthase ThyA (thyA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 99% identity to mtf:TBFG_12777)

MetaCyc: 100% identical to thymidylate synthase subunit (Mycobacterium tuberculosis H37Rv)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)
• folate transformations II (plants) (7/11 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Protein Sequence (263 amino acids)

>Rv2764c Probable thymidylate synthase ThyA (ts) (TSASE) (Mycobacterium tuberculosis H37Rv)
VTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL
WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR
TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS
YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE
YTYEDIVVKNYDPHPAIKAPVAV