Protein Info for Rv2752c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 TIGR00649: beta-CASP ribonuclease, RNase J family" amino acids 17 to 555 (539 residues), 432 bits, see alignment E=1.5e-133 PF00753: Lactamase_B" amino acids 29 to 182 (154 residues), 38.1 bits, see alignment E=3.3e-13 PF12706: Lactamase_B_2" amino acids 59 to 172 (114 residues), 45.8 bits, see alignment E=1.1e-15 PF07521: RMMBL" amino acids 369 to 414 (46 residues), 40.5 bits, see alignment 4.6e-14 PF17770: RNase_J_C" amino acids 462 to 558 (97 residues), 51.7 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 100% identical to RNJ_MYCTO: Ribonuclease J (rnj) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07021, (no description) (inferred from 100% identity to mbo:Mb2773c)

Predicted SEED Role

"Ribonuclease J2 (endoribonuclease in RNA processing)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>Rv2752c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
VDVDLPPPGPLTSGGLRVTALGGINEIGRNMTVFEHLGRLLIIDCGVLFPGHDEPGVDLI
LPDMRHVEDRLDDIEALVLTHGHEDHIGAIPFLLKLRPDIPVVGSKFTLALVAEKCREYR
ITPVFVEVREGQSTRHGVFECEYFAVNHSTPDALAIAVYTGAGTILHTGDIKFDQLPPDG
RPTDLPGMSRLGDTGVDLLLCDSTNAEIPGVGPSESEVGPTLHRLIRGADGRVIVACFAS
NVDRVQQIIDAAVALGRRVSFVGRSMVRNMRVARQLGFLRVADSDLIDIAAAETMAPDQV
VLITTGTQGEPMSALSRMSRGEHRSITLTAGDLIVLSSSLIPGNEEAVFGVIDALSKIGA
RVVTNAQARVHVSGHAYAGELLFLYNGVRPRNVMPVHGTWRMLRANAKLAASTGVPQESI
LLAENGVSVDLVAGKASISGAVPVGKMFVDGLIAGDVGDITLGERLILSSGFVAVTVVVR
RGTGQPLAAPHLHSRGFSEDPKALEPAVRKVEAELESLVAANVTDPIRIAQGVRRTVGKW
VGETYRRQPMIVPTVIEV