Protein Info for Rv2746c in Mycobacterium tuberculosis H37Rv

Annotation: Probable PGP synthase PgsA3 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase) (phosphatidylglycerophosphate synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 62 to 72 (11 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 28 to 187 (160 residues), 158.1 bits, see alignment E=1.2e-50 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 28 to 199 (172 residues), 132.8 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 100% identical to PGSA2_MYCTO: Putative CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyl-transferase 2 (pgsA2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 100% identity to mra:MRA_2772)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>Rv2746c Probable PGP synthase PgsA3 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase) (phosphatidylglycerophosphate synthase) (Mycobacterium tuberculosis H37Rv)
MSRSTRYSVAVSAQPETGQIAGRARIANLANILTLLRLVMVPVFLLALFYGGGHHSAARV
VAWAIFATACITDRFDGLLARNYGMATEFGAFVDPIADKTLIGSALIGLSMLGDLPWWVT
VLILTRELGVTVLRLAVIRRGVIPASWGGKLKTFVQAVAIGLFVLPLSGPLHVAAVVVMA
AAILLTVITGVDYVARALRDIGGIRQTAS