Protein Info for Rv2737c in Mycobacterium tuberculosis H37Rv

Annotation: RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)].

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 TIGR02012: protein RecA" amino acids 6 to 253 (248 residues), 453 bits, see alignment E=8.9e-140 PF00154: RecA" amino acids 9 to 252 (244 residues), 436.6 bits, see alignment E=1e-134 PF08423: Rad51" amino acids 35 to 259 (225 residues), 27.6 bits, see alignment E=5.4e-10 TIGR01445: intein N-terminal splicing region" amino acids 252 to 328 (77 residues), 42.2 bits, see alignment E=1.9e-14 PF14890: Intein_splicing" amino acids 268 to 691 (424 residues), 39.7 bits, see alignment E=1.4e-13 PF14528: LAGLIDADG_3" amino acids 463 to 554 (92 residues), 49.1 bits, see alignment E=1.6e-16 TIGR01443: intein C-terminal splicing region" amino acids 671 to 692 (22 residues), 29 bits, see alignment (E = 1.4e-10) PF21096: RecA_C" amino acids 713 to 769 (57 residues), 87 bits, see alignment 2.1e-28

Best Hits

Swiss-Prot: 100% identical to RECA_MYCTU: Protein RecA (recA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to mtu:Rv2737c)

Predicted SEED Role

"RecA protein @ intein-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (790 amino acids)

>Rv2737c RecA protein (recombinase A) [contains: endonuclease PI-MTUI (MTU RecA intein)]. (Mycobacterium tuberculosis H37Rv)
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRG
RVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQP
DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMT
GALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVG
NRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIP
ADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTRIAATLGCAAHPQGRISLAIA
HRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQ
TGALRVGYTTTSEQLAHQIHWLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVR
ISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVI
REVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAEFDILYGKGISREGSLIDMGV
DQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSN
DGVLPAPVDF