Protein Info for Rv2731 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved alanine and arginine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF03993: DUF349" amino acids 139 to 213 (75 residues), 51.1 bits, see alignment E=7e-18 amino acids 217 to 289 (73 residues), 76.1 bits, see alignment E=1.1e-25 amino acids 294 to 366 (73 residues), 67.5 bits, see alignment E=5.5e-23

Best Hits

Swiss-Prot: 100% identical to Y2757_MYCTA: Uncharacterized protein MRA_2757 (MRA_2757) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: None (inferred from 100% identity to mtc:MT2802)

Predicted SEED Role

"ATPase involved in DNA repair"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>Rv2731 Conserved alanine and arginine rich protein (Mycobacterium tuberculosis H37Rv)
MTADEPRSDDSSGSAPQPAATPVPRPGPRPGPRPVPRPTSYPVGAHPPSDPHRFGRIDDD
GTVWLVSASGERIVGSWQAGDPEAAFAHFGRRFDDLSTEIMLMDERLASGTGDARKIKAH
AIALAETLPTACVLGDVDALADRLTSIRDRAEVIAAADRSRREEHRAAQTARKEALAAEA
EELAANATQWKVAGDRLRAILDEWKTISGVDRKVDDALWKRYSTARDTFNRRRGSHFAEL
DRERSGVRQSKERLCERAEELSESTDWTATSAEFRKLLADWKAAGRASKDVDDALWRRFK
AAQDSFFTARNAATAEKEAELRANADAKEALLAEAERLDTTNHEAARAALRSIAEKWDAI
GKVSRERAAELERRLRAVEKKVREAGEADWSDPQARARAEQFRARAEQFEHQAEKAAAAG
RTKEADEAKANAEQWRQWAEAAADALTRRP