Protein Info for Rv2724c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF02771: Acyl-CoA_dh_N" amino acids 14 to 125 (112 residues), 108.3 bits, see alignment E=5.7e-35 PF02770: Acyl-CoA_dh_M" amino acids 129 to 224 (96 residues), 88.5 bits, see alignment E=5.2e-29 PF00441: Acyl-CoA_dh_1" amino acids 236 to 384 (149 residues), 164.8 bits, see alignment E=3.2e-52 PF08028: Acyl-CoA_dh_2" amino acids 260 to 372 (113 residues), 34.3 bits, see alignment E=5.4e-12

Best Hits

Swiss-Prot: 52% identical to ACADL_PIG: Long-chain specific acyl-CoA dehydrogenase, mitochondrial (ACADL) from Sus scrofa

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 100% identity to mbo:Mb2743c)

MetaCyc: 56% identical to L-cysteinyl-[NRPS] dehydrogenase (Streptomyces clavuligerus)
RXN-16875

Predicted SEED Role

"Acyl-CoA dehydrogenase FadE20"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>Rv2724c Probable acyl-CoA dehydrogenase FadE20 (Mycobacterium tuberculosis H37Rv)
MGSATKYQRTLFEPEHELFRESYRAFLDRHVAPYHDEWEKTKIVDRGVWLEAGKQGFLGM
AVPEEYGGGGNADFRYNTVITEETCAGRYSGIGFGLHNDIVAPYLLALATEEQKRRWFPN
FCTGELITAIAMTEPGTGSDLQGITTRAVKHGDHYVLNGSKTFITNGINSDLVIVVAQTD
PEKGAQGFSLLVVERGMAGFERGRQLDKIGLDAQDTAELSFTDVAVPAENLLGQEGMGFI
YLMQNLPQERISIAIMAAAGMESVLEQTLQYAKERKAFGRSIGSFQNSRFLLAELATEAT
VVRIMVDEFIKLHLAGKLTAEQAAMAKWYATEKQVYLNDRCLQLHGGYGYMREYPVARAY
LDSRVQTIYGGTTEIMKEIIGRGLGV