Protein Info for Rv2721c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved transmembrane alanine and glycine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 421 to 444 (24 residues), see Phobius details PF08310: LGFP" amino acids 59 to 108 (50 residues), 33.2 bits, see alignment 2.8e-12 amino acids 112 to 168 (57 residues), 39.6 bits, see alignment 2.8e-14 amino acids 240 to 289 (50 residues), 44 bits, see alignment 1.2e-15 amino acids 294 to 350 (57 residues), 39 bits, see alignment 4.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtc:MT2794)

Predicted SEED Role

"Uncharacterized protein potentially involved in peptidoglycan biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (699 amino acids)

>Rv2721c Possible conserved transmembrane alanine and glycine rich protein (Mycobacterium tuberculosis H37Rv)
VNGQRGQLSTLIGRTLLGLAATAVTAVLLAPTVAASPMGDAEDAMMAAWEKAGGDTSTLG
VRKGDVYPIGDGFALDFAGGKMFFTPATGAKYLYGPLLDKYESLGGAADSDLGFPTINEV
PGLAGPDSRVSTFSAADNPVIFWTPEHGAFVVRGALNAAWDKLGSSGGVLGAPVGDETYD
GEVTAQKFSGGEVSWNRATKEFTTVPAVLAEQLKGLQVAIDPSAAINMAWRAAGGAAGPL
GAKKGGQYPIGGDGIAQDFVGGKVFFSPATGANAVEGEILAKYESLGGPVSSDLGFPIAN
ETDGGFGPSSRIVRFSAADKPVIFWTPDHGAFVVRGAMVAAWDKLRGPNGKLGAPVGDQT
VDGDVVSQKFTGGMISWNRAKNTFTTDPANLAPLLSGLQVSGQNQPSTSAMPPPGKKFTW
HWWWLGAAALGVLLVVMVALVVFGLRRRRRGYDAAAYDDDRAGDVEYGTAADGDWPPDED
FGSEHFGFGDQFPPEPVAPDAGSTPRVSWPRGAGAAVGDAEHLPGEEGYGSDLLSGPSNV
GVEEEDTDAVDTTPTPVVSQADLSEVGPDLIVPERVVPETFVPQAFVPEAVAPEAVPPDV
HAADLADTGLPAAAVSAAEDRGGRHAAAEPPEPPSAGVRPAIHLPLEDPYQMPNGYPVKA
SVSFGLYYPPGSALYHDTLAELWFASEEVAQVNGFIRAD