Protein Info for Rv2710 in Mycobacterium tuberculosis H37Rv

Annotation: RNA polymerase sigma factor SigB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00140: Sigma70_r1_2" amino acids 25 to 58 (34 residues), 45 bits, see alignment 1.7e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 86 to 311 (226 residues), 125.2 bits, see alignment E=1e-40 PF04542: Sigma70_r2" amino acids 90 to 160 (71 residues), 82.1 bits, see alignment E=4e-27 PF04539: Sigma70_r3" amino acids 169 to 245 (77 residues), 90.3 bits, see alignment E=1.4e-29 PF04545: Sigma70_r4" amino acids 258 to 311 (54 residues), 67.3 bits, see alignment 1.4e-22

Best Hits

Swiss-Prot: 100% identical to SIGB_MYCTU: RNA polymerase sigma factor SigB (sigB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03087, RNA polymerase nonessential primary-like sigma factor (inferred from 100% identity to mbb:BCG_2723)

Predicted SEED Role

"RNA polymerase sigma factor SigB" in subsystem Biofilm formation in Staphylococcus or Methicillin resistance in Staphylococci or SigmaB stress responce regulation or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>Rv2710 RNA polymerase sigma factor SigB (Mycobacterium tuberculosis H37Rv)
MADAPTRATTSRVDSDLDAQSPAADLVRVYLNGIGKTALLNAAGEVELAKRIEAGLYAEH
LLETRKRLGENRKRDLAAVVRDGEAARRHLLEANLRLVVSLAKRYTGRGMPLLDLIQEGN
LGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGMADQSRTIRLPVHLVEQVNKLARIKRE
MHQHLGREATDEELAAESGIPIDKINDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAM
SAENAVIAELLHTDIRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQ
IERDVMSKLRHGERADRLRSYAS