Protein Info for Rv2702 in Mycobacterium tuberculosis H37Rv

Annotation: Polyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00480: ROK" amino acids 22 to 175 (154 residues), 51.2 bits, see alignment E=7e-18

Best Hits

Swiss-Prot: 100% identical to PPGK_MYCTA: Polyphosphate glucokinase (ppgK) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00886, polyphosphate glucokinase [EC: 2.7.1.63] (inferred from 99% identity to mtc:MT2776)

MetaCyc: 100% identical to polyphosphate-dependent glucokinase (Mycobacterium tuberculosis H37Rv)
Polyphosphate--glucose phosphotransferase. [EC: 2.7.1.63]

Predicted SEED Role

"Polyphosphate glucokinase (EC 2.7.1.63)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.63)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>Rv2702 Polyphosphate glucokinase PpgK (polyphosphate-glucose phosphotransferase) (Mycobacterium tuberculosis H37Rv)
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH