Protein Info for Rv2692 in Mycobacterium tuberculosis H37Rv

Annotation: TRK system potassium uptake protein CeoC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF03807: F420_oxidored" amino acids 2 to 86 (85 residues), 25.5 bits, see alignment E=4.9e-09 PF13241: NAD_binding_7" amino acids 2 to 87 (86 residues), 27.5 bits, see alignment E=1.2e-09 PF02558: ApbA" amino acids 3 to 39 (37 residues), 25.1 bits, see alignment 3.6e-09 PF02254: TrkA_N" amino acids 3 to 118 (116 residues), 95.5 bits, see alignment E=8.5e-31 PF13460: NAD_binding_10" amino acids 7 to 77 (71 residues), 28.7 bits, see alignment E=3.6e-10 PF02080: TrkA_C" amino acids 149 to 216 (68 residues), 44.6 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 100% identical to TRKA_MYCTU: Trk system potassium uptake protein TrkA (trkA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to mbb:BCG_2705)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>Rv2692 TRK system potassium uptake protein CeoC (Mycobacterium tuberculosis H37Rv)
MKVAVAGAGAVGRSVTRELVENGHDITLIERNPDHLDAAAIPEAHWRLGDACELSLLESI
HLEEFDVVVAATGDDKVNVVLSLLAKTEFAVPRVVARVNDPRNEWLFNDAWGVDVAVSTP
RMLASLIEEAVTIGDLVRLMEFRTGQANLVEITLPDNTPWGGKPVRKLQLPRDAALVTIL
RGPRVIVPEADEPLEGGDELLFVAVTEAEEELSRLLLPSM