Protein Info for Rv2678c in Mycobacterium tuberculosis H37Rv

Annotation: Probable uroporphyrinogen decarboxylase HemE (uroporphyrinogen III decarboxylase) (URO-D) (UPD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 8 to 356 (349 residues), 401.9 bits, E=1.1e-124
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 12 to 356 (345 residues), 423.5 bits, E=2.8e-131

Best Hits

Swiss-Prot: 100% identical to DCUP_MYCTA: Uroporphyrinogen decarboxylase (hemE) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 100% identity to mbo:Mb2697c)

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis II (oxygen-independent) (2/4 steps found)
• heme b biosynthesis V (aerobic) (2/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (2/6 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (2/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Protein Sequence (357 amino acids)

>Rv2678c Probable uroporphyrinogen decarboxylase HemE (uroporphyrinogen III decarboxylase) (URO-D) (UPD) (Mycobacterium tuberculosis H37Rv)
MSTRRDLPQSPYLAAVTGRKPSRVPVWFMRQAGRSLPEYRALRERYSMLAACFEPDVACE
ITLQPIRRYDVDAAILFSDIVVPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQ
AIQPVLVAASLLVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHVKAMMLAEPASWHA
LMAKLTDLTIAFLVGQIDAGVDAIQVFDSWAGALSPIDYRQYVLPHSARVFAALGEHGVP
MTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTDAAARVVPGTALQGNLDPAV
VLAGWPAVERAARAVVDDGRRAVDAGAAGHIFNLGHGVLPESDPAVLADLVSLVHSL