Protein Info for Rv2673 in Mycobacterium tuberculosis H37Rv

Annotation: Possible arabinofuranosyltransferase AftC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 95 to 110 (16 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 333 to 352 (20 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 388 to 407 (20 residues), see Phobius details PF09594: GT87" amino acids 94 to 328 (235 residues), 155.4 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 100% identical to AFTC_MYCTO: Alpha-(1->3)-arabinofuranosyltransferase (aftC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01300)

MetaCyc: 100% identical to arabinogalactan alpha(1-->3) arabinofuranosyltransferase (Mycobacterium tuberculosis H37Rv)
RXN-11092 [EC: 2.4.2.47]; RXN-21427 [EC: 2.4.2.47]

Predicted SEED Role

"Putative membrane protein Q2 colocalized with Q" in subsystem Experimental tye

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>Rv2673 Possible arabinofuranosyltransferase AftC (Mycobacterium tuberculosis H37Rv)
VYGALVTAADSIRTGLGASLLAGFRPRTGAPSTATILRSALWPAAVLSVLHRSIVLTTNG
NITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTLLMAPFGYLPFAPSRYLFI
SINTAAILVAAYLLLRMFNFTLTSVAAPALILAMFATETVTNTLVFTNINGCILLLEVLF
LRWLLDGRASRQWCGGLAIGLTLVLKPLLGPLLLLPLLNRQWRALVAAVVVPVVVNVAAL
PLVSDPMSFFTRTLPYILGTRDYFNSSILGNGVYFGLPTWLILFLRILFTAITFGALWLL
YRYYRTGDPLFWFTTSSGVLLLWSWLVMSLAQGYYSMMLFPFLMTVVLPNSVIRNWPAWL
GVYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVTFTVLYFRYLDAKADNRLDGGI
DPAWLTPEREGQR