Protein Info for Rv2671 in Mycobacterium tuberculosis H37Rv

Annotation: Possible bifunctional enzyme riboflavin biosynthesis protein RibD: diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino)uracil reductase (HTP reductase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01872: RibD_C
  • amino acids 40 to 251 (212 residues), 166.8 bits, E=2.8e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01302)

Predicted SEED Role

"5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193) homolog" (EC 1.1.1.193)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• toxoflavin biosynthesis (3/7 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.193

Use Curated BLAST to search for 1.1.1.193

Protein Sequence (258 amino acids)

>Rv2671 Possible bifunctional enzyme riboflavin biosynthesis protein RibD: diaminohydroxyphosphoribosylaminopyrimidine deaminase (riboflavin-specific deaminase) + 5-amino-6-(5-phosphoribosylamino)uracil reductase (HTP reductase) (Mycobacterium tuberculosis H37Rv)
MPDSGQLGAADTPLRLLSSVHYLTDGELPQLYDYPDDGTWLRANFISSLDGGATVDGTSG
AMAGPGDRFVFNLLRELADVIVVGVGTVRIEGYSGVRMGVVQRQHRQARGQSEVPQLAIV
TRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVS
QLAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRC
AHVLTDDSGYLYTRYVKT