Protein Info for Rv2667 in Mycobacterium tuberculosis H37Rv

Annotation: Possible ATP-dependent protease ATP-binding subunit ClpC2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF02861: Clp_N" amino acids 98 to 210 (113 residues), 82 bits, see alignment E=2.2e-27 amino acids 172 to 238 (67 residues), 37 bits, see alignment E=1.8e-13

Best Hits

Swiss-Prot: 100% identical to Y2686_MYCBO: Uncharacterized protein Mb2686 (BQ2027_MB2686) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2674)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>Rv2667 Possible ATP-dependent protease ATP-binding subunit ClpC2 (Mycobacterium tuberculosis H37Rv)
MPEPTPTAYPVRLDELINAIKRVHSDVLDQLSDAVLAAEHLGEIADHLIGHFVDQARRSG
ASWSDIGKSMGVTKQAAQKRFVPRAEATTLDSNQGFRRFTPRARNAVVAAQNAAHGAASS
EITPDHLLLGVLTDPAALATALLQQQEIDIATLRTAVTLPPAVTEPPQPIPFSGPARKVL
ELTFREALRLGHNYIGTEHLLLALLELEDGDGPLHRSGVDKSRAEADLITTLASLTGANA
AGATDAGATDAG