Protein Info for Rv2637 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transmembrane protein DedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 13 to 42 (30 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 32 to 162 (131 residues), 71.7 bits, see alignment E=3.9e-24

Best Hits

Swiss-Prot: 100% identical to Y2637_MYCTO: Uncharacterized membrane protein MT2715 (MT2715) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12655)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>Rv2637 Possible transmembrane protein DedA (Mycobacterium tuberculosis H37Rv)
MDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPELAVNPIGVGGA
AVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHVALAERLFNRWGVRAVFLGRF
IALLRIFAGPLAGALKMPYPRFLAANVTGGICWAGGTTALVYFAGMAAQHWLERFSWIAL
VIAVIAGITAAILLRERTSRAIAELEAEHCRKAGTTAA