Protein Info for Rv2624c in Mycobacterium tuberculosis H37Rv

Annotation: Universal stress protein family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00582: Usp" amino acids 9 to 140 (132 residues), 77.4 bits, see alignment E=8.2e-26

Best Hits

Swiss-Prot: 100% identical to Y2624_MYCTU: Universal stress protein Rv2624c (Rv2624c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12643)

Predicted SEED Role

"Universal stress protein family" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>Rv2624c Universal stress protein family protein (Mycobacterium tuberculosis H37Rv)
MSGRGEPTMKTIIVGIDGSHAAITAALWGVDEAISRAVPLRLVSVIKPTHPSPDDYDRDL
AHAERSLREAQSAVEAAGKLVKIETDIPRGPAGPVLVEASRDAEMICVGSVGIGRYASSI
LGSTATELAEKAHCPVAVMRSKVDQPASDINWIVVRMTDAPDNEAVLEYAAREAKLRQAP
ILALGGRPEELREIPDGEFERRVQDWHHRHPDVRVYPITTHTGIARFLADHDERVQLAVI
GGGEAGQLARLVGPSGHPVFRHAECSVLVVRR