Protein Info for Rv2610c in Mycobacterium tuberculosis H37Rv

Annotation: Alpha-mannosyltransferase PimA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF13439: Glyco_transf_4" amino acids 14 to 173 (160 residues), 91.8 bits, see alignment E=1.6e-29 PF13579: Glyco_trans_4_4" amino acids 15 to 153 (139 residues), 44.7 bits, see alignment E=5.7e-15 PF20706: GT4-conflict" amino acids 163 to 305 (143 residues), 29.3 bits, see alignment E=1.4e-10 PF00534: Glycos_transf_1" amino acids 187 to 344 (158 residues), 102.3 bits, see alignment E=6.9e-33 PF13692: Glyco_trans_1_4" amino acids 189 to 332 (144 residues), 115.9 bits, see alignment E=5.6e-37 PF13524: Glyco_trans_1_2" amino acids 216 to 361 (146 residues), 26.2 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 100% identical to PIMA_MYCTO: Phosphatidyl-myo-inositol mannosyltransferase (pimA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K08256, phosphatidylinositol alpha-mannosyltransferase [EC: 2.4.1.57] (inferred from 100% identity to mtc:MT2685)

Predicted SEED Role

"Phosphatidylinositol alpha-mannosyltransferase (EC 2.4.1.57)" (EC 2.4.1.57)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>Rv2610c Alpha-mannosyltransferase PimA (Mycobacterium tuberculosis H37Rv)
MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPI
PYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTS
TTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAAR
LDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGR
LAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR
VLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQI
MRVYETVAGSGAKVQVAS