Protein Info for Rv2607 in Mycobacterium tuberculosis H37Rv

Annotation: Probable pyridoxamine 5'-phosphate oxidase PdxH (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR00558: pyridoxamine 5'-phosphate oxidase" amino acids 35 to 214 (180 residues), 200.1 bits, see alignment E=1.7e-63 PF01243: Putative_PNPOx" amino acids 49 to 134 (86 residues), 62.7 bits, see alignment E=2.9e-21 PF10590: PNP_phzG_C" amino acids 188 to 224 (37 residues), 51 bits, see alignment 1e-17

Best Hits

Swiss-Prot: 100% identical to PDXH_MYCBT: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 100% identity to mtf:TBFG_12626)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>Rv2607 Probable pyridoxamine 5'-phosphate oxidase PdxH (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase) (Mycobacterium tuberculosis H37Rv)
MDDDAQMVAIDKDQLARMRGEYGPEKDGCGDLDFDWLDDGWLTLLRRWLNDAQRAGVSEP
NAMVLATVADGKPVTRSVLCKILDESGVAFFTSYTSAKGEQLAVTPYASATFPWYQLGRQ
AHVQGPVSKVSTEEIFTYWSMRPRGAQLGAWASQQSRPVGSRAQLDNQLAEVTRRFADQD
QIPVPPGWGGYRIAPEIVEFWQGRENRMHNRIRVANGRLERLQP