Protein Info for Rv2605c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA thioesterase II TesB2 (TEII)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00189: acyl-CoA thioesterase II
  • amino acids 7 to 271 (265 residues), 325.1 bits, E=2e-101
• PF13622: 4HBT_3
  • amino acids 31 to 107 (77 residues), 60.6 bits, E=2.1e-20
• PF02551: Acyl_CoA_thio
  • amino acids 141 to 269 (129 residues), 164.9 bits, E=1.3e-52
• PF20789: 4HBT_3C
  • amino acids 142 to 269 (128 residues), 91.6 bits, E=7.8e-30

Best Hits

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 99% identity to mbb:BCG_2630c)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (281 amino acids)

>Rv2605c Probable acyl-CoA thioesterase II TesB2 (TEII) (Mycobacterium tuberculosis H37Rv)
VSIEEILDLEQLEVNIYRGSVFSPESGFLQRTFGGHVAGQSLVSAVRTVDPRYMVHSLHG
YFLRPGDAKERTVFLVERIRDGGSFCTRRVNAVQHGETIFSMAASFQTEQEGITHQDVMP
AAPPPDGLPGLNSIKVFDDAGFRQFDEWDVCIVPRERLRLLPGKASQQQVWLRHRDPLPD
DPVLHICALAYMSDLTLLGSAQVNHLDVRDQLQVASLDHAMWFMRPFRADEWLLYDQSSP
SASGGRALTRGEIFTRSGEMVAAVMQEGLTRHRRGHRSVGQ