Protein Info for Rv2603c in Mycobacterium tuberculosis H37Rv

Annotation: Highly conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 238 (238 residues), 334.7 bits, see alignment E=1.7e-104 PF20772: TACO1_YebC_N" amino acids 5 to 76 (72 residues), 103 bits, see alignment E=9.7e-34 PF01709: Transcrip_reg" amino acids 84 to 238 (155 residues), 192 bits, see alignment E=6e-61

Best Hits

Swiss-Prot: 100% identical to Y2631_MYCTA: Probable transcriptional regulatory protein MRA_2631 (MRA_2631) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: None (inferred from 100% identity to mtc:MT2678)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>Rv2603c Highly conserved protein (Mycobacterium tuberculosis H37Rv)
MSGHSKWATTKHKKAVVDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSS
VPNENIERARKRGAGEEAGGADWQTIMYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTR
NGGTMADPGSVSYLFSRKGVVTLEKNGLTEDDVLAAVLEAGAEDVNDLGDSFEVISEPAE
LVAVRSALQDAGIDYESAEASFQPSVSVPVDLDGARKVFKLVDALEDSDDVQNVWTNVDV
SDEVLAALDDE