Protein Info for Rv2589 in Mycobacterium tuberculosis H37Rv

Annotation: 4-aminobutyrate aminotransferase GabT (gamma-amino-N-butyrate transaminase) (GABA transaminase) (glutamate:succinic semialdehyde transaminase) (GABA aminotransferase) (GABA-at)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to GABT_MYCBO: 4-aminobutyrate aminotransferase (gabT) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K07250, 4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC: 2.6.1.19 2.6.1.22] (inferred from 100% identity to mtu:Rv2589)

Predicted SEED Role

"Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)" (EC 2.6.1.19)

MetaCyc Pathways

L-valine degradation I (7/8 steps found)
superpathway of 4-aminobutanoate degradation (3/3 steps found)
4-aminobutanoate degradation I (2/2 steps found)
4-aminobutanoate degradation II (2/2 steps found)
4-aminobutanoate degradation III (2/2 steps found)
GABA shunt I (3/4 steps found)
GABA shunt II (3/4 steps found)
4-aminobutanoate degradation V (3/7 steps found)
superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
superpathway of L-arginine and L-ornithine degradation (6/13 steps found)
nicotine degradation I (pyridine pathway) (5/17 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.19 or 2.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>Rv2589 4-aminobutyrate aminotransferase GabT (gamma-amino-N-butyrate transaminase) (GABA transaminase) (glutamate:succinic semialdehyde transaminase) (GABA aminotransferase) (GABA-at) (Mycobacterium tuberculosis H37Rv)
VASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATNGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLDWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIERARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL