Protein Info for Rv2579 in Mycobacterium tuberculosis H37Rv

Annotation: Possible haloalkane dehalogenase DhaA (1-chlorohexane halidohydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00561: Abhydrolase_1" amino acids 32 to 279 (248 residues), 70.4 bits, see alignment E=1.9e-23 PF12697: Abhydrolase_6" amino acids 33 to 283 (251 residues), 46.9 bits, see alignment E=5.8e-16

Best Hits

Swiss-Prot: 100% identical to DHAA_MYCTO: Haloalkane dehalogenase 3 (dhaA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 99% identity to mbo:Mb2610)

MetaCyc: 40% identical to Renilla luciferase (Renilla reniformis)
Renilla-luciferin 2-monooxygenase. [EC: 1.13.12.5]

Predicted SEED Role

"Haloalkane dehalogenase (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.5

Use Curated BLAST to search for 1.13.12.5 or 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv2579 Possible haloalkane dehalogenase DhaA (1-chlorohexane halidohydrolase) (Mycobacterium tuberculosis H37Rv)
MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLV
ACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWAN
QHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAIL
RQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKL
FINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV