Protein Info for Rv2571c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transmembrane alanine and valine and leucine rich protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 37 to 163 (127 residues), 60.2 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 100% identical to Y2571_MYCTO: Uncharacterized protein MT2647 (MT2647) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_2594c)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>Rv2571c Probable transmembrane alanine and valine and leucine rich protein (Mycobacterium tuberculosis H37Rv)
MSASLLVRTACGGRAVAQRLRTVLWPITQTSVVAGLAWYLTHDVFNHPQAFFAPISAVVC
MSATNVLRARRAQQMIVGVALGIVLGAGVHALLGSGPIAMGVVVFIALSVAVLCARGLVA
QGLMFINQAAVSAVLVLVFASNGSVVFERLFDALVGGGLAIVFSILLFPPDPVVMLCSAR
ADVLAAVRDILAELVNTVSDPTSAPPDWPMAAADRLHQQLNGLIEVRANAAMVARRAPRR
WGVRSTVRDLDQQAVYLALLVSSVLHLARTIAGPGGDKLPTPVHAVLTDLAAGTGLADAD
PTAANEHAAAARATASTLQSAACGSNEVVRADIVQACVTDLQRVIERPGPSGMSA