Protein Info for Rv2544 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved lipoprotein LppB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details PF16708: LppA" amino acids 42 to 194 (153 residues), 129.4 bits, see alignment E=5.4e-42

Best Hits

Swiss-Prot: 100% identical to LPPB_MYCTU: Putative lipoprotein LppB (lppB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT2620)

Predicted SEED Role

"Lipoprotein LppB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>Rv2544 Probable conserved lipoprotein LppB (Mycobacterium tuberculosis H37Rv)
LIAPQPIPRTLPRWQRIVALTMIGISTALIGGCTMGQNPDKSPHLTGEQKIQLIDSMRHK
GSYEAARERLTATAQIIADRVSAAIPGQTWKFNDDSYGQDFYRNGSLCKELSADIARRPM
AKPVDFGSTFSAEDFKIAANIVREEAAKYGVTTESSLFNESAKRDYDVQGNGYEFNLGQI
KFATLNITGDCFLLQKVLDLPAGQLPPEPPIWPTTSTPTP