Protein Info for Rv2523c in Mycobacterium tuberculosis H37Rv

Annotation: holo-[acyl-carrier protein] synthase AcpS (holo-ACP synthase) (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00556: phosphopantetheine--protein transferase domain
  • amino acids 3 to 129 (127 residues), 136.5 bits, E=2.8e-44
• PF01648: ACPS
  • amino acids 5 to 105 (101 residues), 56.2 bits, E=1.6e-19

Best Hits

Swiss-Prot: 100% identical to ACPS_MYCBP: Holo-[acyl-carrier-protein] synthase (acpS) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 100% identity to mra:MRA_2550)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

• acyl carrier protein activation (1/1 steps found)
• acyl carrier protein metabolism (1/2 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• enterobactin biosynthesis (4/11 steps found)
• petrobactin biosynthesis (1/10 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Protein Sequence (130 amino acids)

>Rv2523c holo-[acyl-carrier protein] synthase AcpS (holo-ACP synthase) (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase) (Mycobacterium tuberculosis H37Rv)
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAV
IKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDT
AAAVAILEAP