Protein Info for Rv2509 in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 12 to 189 (178 residues), 41.2 bits, E=3.6e-14
• PF00106: adh_short
  • amino acids 12 to 196 (185 residues), 129.9 bits, E=1.7e-41
• PF13561: adh_short_C2
  • amino acids 16 to 197 (182 residues), 82.5 bits, E=7.2e-27

Best Hits

KEGG orthology group: K07124, (no description) (inferred from 100% identity to mbt:JTY_2523)

MetaCyc: 100% identical to Rv2509 (Mycobacterium tuberculosis H37Rv)
1.1.-.-; 1.1.-.-; 1.1.-.-; 1.1.-.-; 1.1.-.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• mycolate biosynthesis (165/205 steps found)
• superpathway of mycolate biosynthesis (166/239 steps found)

Protein Sequence (268 amino acids)

>Rv2509 Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
MPIPAPSPDARAVVTGASQNIGAALATELAARGHHLIVTARREDVLTELAARLADKYRVT
VDVRPADLADPQERSKLADELAARPISILCANAGTATFGPIASLDLAGEKTQVQLNAVAV
HDLTLAVLPGMIERKAGGILISGSAAGNSPIPYNATYAATKAFVNTFSESLRGELRGSGV
HVTVLAPGPVRTELPDASEASLVEKLVPDFLWISTEHTARVSLNALERNKMRVVPGLTSK
AMSVASQYAPRAIVAPIVGAFYKRLGGS