Protein Info for Rv2504c in Mycobacterium tuberculosis H37Rv

Annotation: Probable succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subunit) ScoA (3-oxo acid:CoA transferase) (OXCT A) (succinyl-CoA:3-oxoacid-coenzyme A transferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 1 to 235 (235 residues), 232.1 bits, E=2.5e-73
• PF01144: CoA_trans
  • amino acids 6 to 233 (228 residues), 264.2 bits, E=3.9e-83

Best Hits

Swiss-Prot: 100% identical to SCOA_MYCTO: Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (scoA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 100% identity to mtu:Rv2504c)

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

• TCA cycle VI (Helicobacter) (9/9 steps found)
• ketolysis (2/3 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Synthesis and degradation of ketone bodies
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Protein Sequence (248 amino acids)

>Rv2504c Probable succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subunit) ScoA (3-oxo acid:CoA transferase) (OXCT A) (succinyl-CoA:3-oxoacid-coenzyme A transferase) (Mycobacterium tuberculosis H37Rv)
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ