Protein Info for Rv2504c in Mycobacterium tuberculosis H37Rv

Annotation: Probable succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subunit) ScoA (3-oxo acid:CoA transferase) (OXCT A) (succinyl-CoA:3-oxoacid-coenzyme A transferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 1 to 235 (235 residues), 232.1 bits, see alignment E=2.5e-73 PF01144: CoA_trans" amino acids 6 to 233 (228 residues), 265.5 bits, see alignment E=1.5e-83

Best Hits

Swiss-Prot: 100% identical to SCOA_MYCTO: Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (scoA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 100% identity to mtu:Rv2504c)

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>Rv2504c Probable succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subunit) ScoA (3-oxo acid:CoA transferase) (OXCT A) (succinyl-CoA:3-oxoacid-coenzyme A transferase) (Mycobacterium tuberculosis H37Rv)
MDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETVSNNCGIDGVG
LGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQGTLAERLRAGGMGIPAFYTP
AGVGTQVADGGLPWRYDASGGVAVVSPAKETREFDGVTYVLERGIRTDFALVHAWQGDRH
GNLMYRHAAANFNPECASAGRITIAEVEHLVEPGEIDPATVHTPGVFVHRVVHVPNPAKK
IERETVRQ