Protein Info for Rv2462c in Mycobacterium tuberculosis H37Rv

Annotation: Probable trigger factor (TF) protein Tig

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF05697: Trigger_N" amino acids 2 to 144 (143 residues), 139.4 bits, see alignment E=1.7e-44 TIGR00115: trigger factor" amino acids 12 to 416 (405 residues), 372.1 bits, see alignment E=1.7e-115 PF00254: FKBP_C" amino acids 159 to 218 (60 residues), 24.8 bits, see alignment E=3.3e-09 PF05698: Trigger_C" amino acids 258 to 418 (161 residues), 139.6 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 100% identical to TIG_MYCTA: Trigger factor (tig) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to mbo:Mb2489c)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>Rv2462c Probable trigger factor (TF) protein Tig (Mycobacterium tuberculosis H37Rv)
VKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAPAKLLEARIGR
EAMLDQIVNDALPSRYGQAVAESDVQPLGRPNIEVTKKEYGQDLQFTAEVDIRPKISPPD
LSALTVSVDPIEIGEDDVDAELQSLRTRFGTLTAVDRPVAVGDVVSIDLSATVDGEDIPN
AAAEGLSHEVGSGRLIAGLDDAVVGLSADESRVFTAKLAAGEHAGQEAQVTVTVRSVKER
ELPEPDDEFAQLASEFDSIDELRASLSDQVRQAKRAQQAEQIRNATIDALLEQVDVPLPE
SYVQAQFDSVLHSALSGLNHDEARFNELLVEQGSSRAAFDAEARTASEKDVKRQLLLDAL
ADELQVQVGQDDLTERLVTTSRQYGIEPQQLFGYLQERNQLPTMFADVRRELAIRAAVEA
ATVTDSDGNTIDTSEFFGKRVSAGEAEEAEPADEGAARAASDEATT