Protein Info for Rv2443 in Mycobacterium tuberculosis H37Rv

Annotation: Probable C4-dicarboxylate-transport transmembrane protein DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 347 to 372 (26 residues), see Phobius details PF00375: SDF" amino acids 26 to 418 (393 residues), 321.9 bits, see alignment E=3.2e-100

Best Hits

Swiss-Prot: 49% identical to DCTA_DEIDV: C4-dicarboxylate transport protein (dctA) from Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to mtb:TBMG_01529)

MetaCyc: 47% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate-transport transmembrane protein DctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>Rv2443 Probable C4-dicarboxylate-transport transmembrane protein DctA (Mycobacterium tuberculosis H37Rv)
MTAPLDRAPVTDLPANNKGRDRTHWLYLAVIFAVIAGVIVGLTAPSTGKSLTVLGTVFVN
LIKMMIAPVIFCTIVLGIGSVRKAAAVGKVGGLALAYFLTMSSVALGIGLIVGNLLSPGR
DLHLRPGAVGSGAALAGQAAESHGIAGFIQQIIPRSLPSALTEGNVLQVLLVALLVGFAV
QGLGPAGESILRAVENLQKLVFKVLVMVLWLAPIGAFGAIANIVATTGFNAVTNLLLLMA
GFYLTCVVFVFGVLGVLLRIVSGLSIFRLLRYLAREYLLIFATSSSEVVLPRLITKMKHL
GVQSSTVGVVVPTGYSFNLDGTAIYLTMASLFIADAMGHRLTWGEQIALLAFMIIASKGA
AGVSGAGLATLAGGLQAHRPELLDGVGLIVGIDRFMSEARSLTNFSGNAVATILVASWTK
TIDLSKADEVLRGRDPFDESTMVDPHDEEPPAATPHGGGVPTNPALCDFEQVSLGGLVGR
PAGPQRADVDG