Protein Info for Rv2440c in Mycobacterium tuberculosis H37Rv

Annotation: Probable GTP1/Obg-family GTP-binding protein Obg

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR02729: Obg family GTPase CgtA" amino acids 4 to 338 (335 residues), 407 bits, see alignment E=5.4e-126 PF01018: GTP1_OBG" amino acids 5 to 158 (154 residues), 177.7 bits, see alignment E=2.6e-56 PF01926: MMR_HSR1" amino acids 161 to 256 (96 residues), 76.6 bits, see alignment E=3.3e-25 PF02421: FeoB_N" amino acids 162 to 248 (87 residues), 29.8 bits, see alignment E=8.1e-11 PF09269: DUF1967" amino acids 366 to 434 (69 residues), 78.9 bits, see alignment E=4.7e-26 TIGR03595: Obg family GTPase CgtA, C-terminal extension" amino acids 366 to 435 (70 residues), 86.7 bits, see alignment E=7e-29

Best Hits

Swiss-Prot: 100% identical to OBG_MYCTO: GTPase Obg (obg) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03979, GTP-binding protein (inferred from 100% identity to mtf:TBFG_12467)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>Rv2440c Probable GTP1/Obg-family GTP-binding protein Obg (Mycobacterium tuberculosis H37Rv)
VPRFVDRVVIHTRAGSGGNGCASVHREKFKPLGGPDGGNGGRGGSIVFVVDPQVHTLLDF
HFRPHLTAASGKHGMGNNRDGAAGADLEVKVPEGTVVLDENGRLLADLVGAGTRFEAAAG
GRGGLGNAALASRVRKAPGFALLGEKGQSRDLTLELKTVADVGLVGFPSAGKSSLVSAIS
AAKPKIADYPFTTLVPNLGVVSAGEHAFTVADVPGLIPGASRGRGLGLDFLRHIERCAVL
VHVVDCATAEPGRDPISDIDALETELACYTPTLQGDAALGDLAARPRAVVLNKIDVPEAR
ELAEFVRDDIAQRGWPVFCVSTATRENLQPLIFGLSQMISDYNAARPVAVPRRPVIRPIP
VDDSGFTVEPDGHGGFVVSGARPERWIDQTNFDNDEAVGYLADRLARLGVEEELLRLGAR
SGCAVTIGEMTFDWEPQTPAGEPVAMSGRGTDPRLDSNKRVGAAERKAARSRRREHGDG