Protein Info for Rv2439c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glutamate 5-kinase protein ProB (gamma-glutamyl kinase) (GK)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 14 to 366 (353 residues), 458.4 bits, E=9.3e-142
• PF00696: AA_kinase
  • amino acids 15 to 239 (225 residues), 134.4 bits, E=5.5e-43
• PF01472: PUA
  • amino acids 281 to 350 (70 residues), 59.1 bits, E=3.4e-20

Best Hits

Swiss-Prot: 100% identical to PROB_MYCTU: Glutamate 5-kinase (proB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to mbo:Mb2466c)

MetaCyc: 40% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Protein Sequence (376 amino acids)

>Rv2439c Probable glutamate 5-kinase protein ProB (gamma-glutamyl kinase) (GK) (Mycobacterium tuberculosis H37Rv)
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVAAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV