Protein Info for Rv2429 in Mycobacterium tuberculosis H37Rv

Annotation: Alkyl hydroperoxide reductase D protein AhpD (alkyl hydroperoxidase D)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR00777: alkylhydroperoxidase, AhpD family" amino acids 2 to 177 (176 residues), 319.1 bits, see alignment E=7.4e-100 PF02627: CMD" amino acids 101 to 174 (74 residues), 54.5 bits, see alignment E=4.8e-19 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 111 to 159 (49 residues), 69.7 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 100% identical to AHPD_MYCBO: Alkyl hydroperoxide reductase AhpD (ahpD) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K04756, alkyl hydroperoxide reductase subunit D (inferred from 100% identity to mtc:MT2504)

Predicted SEED Role

"Alkylhydroperoxidase protein D" in subsystem Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>Rv2429 Alkyl hydroperoxide reductase D protein AhpD (alkyl hydroperoxidase D) (Mycobacterium tuberculosis H37Rv)
MSIEKLKAALPEYAKDIKLNLSSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEAT
DHLSAAARHAALGAAAIMGMNNVFYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELW
SFAVSAINGCSHCLVAHEHTLRTVGVDREAIFEALKAAAIVSGVAQALATIEALSPS