Protein Info for Rv2416c in Mycobacterium tuberculosis H37Rv

Annotation: Enhanced intracellular survival protein Eis,GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF13527: Acetyltransf_9" amino acids 9 to 133 (125 residues), 85.1 bits, see alignment E=6.4e-28 PF17668: Acetyltransf_17" amino acids 188 to 298 (111 residues), 64.6 bits, see alignment E=2e-21 PF13530: SCP2_2" amino acids 301 to 395 (95 residues), 55 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 100% identical to EIS_MYCTU: N-acetyltransferase Eis (eis) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbo:Mb2439c)

Predicted SEED Role

"Enhanced intracellular survival protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>Rv2416c Enhanced intracellular survival protein Eis,GCN5-related N-acetyltransferase (Mycobacterium tuberculosis H37Rv)
VTVTLCSPTEDDWPGMFLLAAASFTDFIGPESATAWRTLVPTDGAVVVRDGAGPGSEVVG
MALYMDLRLTVPGEVVLPTAGLSFVAVAPTHRRRGLLRAMCAELHRRIADSGYPVAALHA
SEGGIYGRFGYGPATTLHELTVDRRFARFHADAPGGGLGGSSVRLVRPTEHRGEFEAIYE
RWRQQVPGGLLRPQVLWDELLAECKAAPGGDRESFALLHPDGYALYRVDRTDLKLARVSE
LRAVTADAHCALWRALIGLDSMERISIITHPQDPLPHLLTDTRLARTTWRQDGLWLRIMN
VPAALEARGYAHEVGEFSTVLEVSDGGRFALKIGDGRARCTPTDAAAEIEMDRDVLGSLY
LGAHRASTLAAANRLRTKDSQLLRRLDAAFASDVPVQTAFEF