Protein Info for Rv2400c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sulfate-binding lipoprotein SubI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF13531: SBP_bac_11" amino acids 62 to 303 (242 residues), 108.9 bits, see alignment E=5e-35 PF01547: SBP_bac_1" amino acids 68 to 295 (228 residues), 47.6 bits, see alignment E=3.6e-16 TIGR00971: sulfate ABC transporter, sulfate-binding protein" amino acids 74 to 341 (268 residues), 159.5 bits, see alignment E=5.9e-51 PF13416: SBP_bac_8" amino acids 76 to 311 (236 residues), 37.5 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K02048, sulfate transport system substrate-binding protein (inferred from 100% identity to mbo:Mb2422c)

Predicted SEED Role

"Sulfate and thiosulfate binding protein CysP" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>Rv2400c Probable sulfate-binding lipoprotein SubI (Mycobacterium tuberculosis H37Rv)
MLSLTLSEASCIASASRWRHIIPAGVVCALIAGIGVGCHGGPSDVVGRAGPDRAHTSITL
VAYAVPEPGWSAVIPAFNASEQGRGVQVITSYGASADQSRGVADGKPADLVNFSVEPDIA
RLVKAGKVDKDWDADATKGIPFGSVVTFVVRAGNPKNIRDWDDLLRPGIEVITPSPLSSG
SAKWNLLAPYAAKSDGGRNNQAGIDFVNTLVNEHVKLRPGSGREATDVFVQGSGDVLISY
ENEAIATERAGKPVQHVTPPQTFKIENPLAVVATSTHLGAATAFRNFQYTVQAQKLWAQA
GFRPVDPAVAADFADLFPVPAKLWTIADLGGWGSVDPQLFDKATGSITKIYLRATG