Protein Info for Rv2399c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sulfate-transport integral membrane protein ABC transporter CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 72 to 98 (27 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 28 to 276 (249 residues), 271.7 bits, see alignment E=7.2e-85 TIGR00969: sulfate ABC transporter, permease protein" amino acids 28 to 273 (246 residues), 248.8 bits, see alignment E=7e-78 PF00528: BPD_transp_1" amino acids 87 to 275 (189 residues), 71 bits, see alignment E=5.5e-24

Best Hits

Swiss-Prot: 43% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 100% identity to mtc:MT2470)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>Rv2399c Probable sulfate-transport integral membrane protein ABC transporter CysT (Mycobacterium tuberculosis H37Rv)
MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW
LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT
IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA
SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT
LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA