Protein Info for Rv2398c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sulfate-transport integral membrane protein ABC transporter CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 54 to 81 (28 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 8 to 266 (259 residues), 383.6 bits, see alignment E=4.8e-119 TIGR00969: sulfate ABC transporter, permease protein" amino acids 9 to 264 (256 residues), 360.7 bits, see alignment E=5.3e-112 PF00528: BPD_transp_1" amino acids 73 to 265 (193 residues), 49.8 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 35% identical to CYST_MESVI: Probable sulfate transport system permease protein cysT (cysT) from Mesostigma viride

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 99% identity to mtf:TBFG_12426)

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>Rv2398c Probable sulfate-transport integral membrane protein ABC transporter CysW (Mycobacterium tuberculosis H37Rv)
MTSLPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLL
VVAIVVPLNVIFGVTTALVLARNRFRGKGVLQAIIDLPFAVSPVIVGVSLILLWGSAGAL
GFVEQDLGFKIIFGLPGIVLGSMFVTCPFVVREVEPVLHELGTDQEQAAATLGSGWWQTF
WRITLPSIRWGLTYGIVLTVARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGA
YALSTLLMAVSVVVLIVQMVLDARRARAVSEG