Protein Info for Rv2397c in Mycobacterium tuberculosis H37Rv

Annotation: Sulfate-transport ATP-binding protein ABC transporter CysA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 5 to 241 (237 residues), 432 bits, see alignment E=2.9e-134 PF00005: ABC_tran" amino acids 20 to 162 (143 residues), 133.2 bits, see alignment E=2.7e-42 PF08402: TOBE_2" amino acids 245 to 325 (81 residues), 24.5 bits, see alignment E=6.2e-09 PF12857: TOBE_3" amino acids 270 to 325 (56 residues), 39.9 bits, see alignment E=7.8e-14 PF03459: TOBE" amino acids 273 to 324 (52 residues), 26.3 bits, see alignment 1.8e-09

Best Hits

Swiss-Prot: 100% identical to CYSA_MYCTO: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to mtf:TBFG_12425)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>Rv2397c Sulfate-transport ATP-binding protein ABC transporter CysA1 (Mycobacterium tuberculosis H37Rv)
MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGT
ITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQ
VVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRL
HDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST
LNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST