Protein Info for Rv2396 in Mycobacterium tuberculosis H37Rv

Annotation: PE-PGRS family protein PE_PGRS41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00934: PE" amino acids 4 to 94 (91 residues), 114.2 bits, see alignment E=1.4e-37

Best Hits

Swiss-Prot: 56% identical to PG33_MYCTO: PE-PGRS family protein PE_PGRS33 (PE_PGRS33) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_2420)

Predicted SEED Role

"PE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>Rv2396 PE-PGRS family protein PE_PGRS41 (Mycobacterium tuberculosis H37Rv)
MSFLIASPEALAATATYLTGIGSAISAANAVAAAPTTEILAAGTDEVSTAISALFGAHAQ
AYQALSAHVAAFHDQFVHTLTAGAGSYMAAEAAAASPLQALQLELLNAINAPTLALLGRP
LIGDGTDAAPGSGGAGGAGGILIGNGGTGGASDLAGTGRGGVGGAGGAGGLFGIGGAGGG
CGSAVAIGGDGGAGGAGGVFSGGGAGGAGDAIGGSGGAGGTGGLLGGGGGAGGAGGAGGN
GGGASNSASIGGDGGSGGAGGMLYGAGGVGGNGGAAVAIGGDGGAGGRAGAIGNGGDGGN
GGTSNTPGGSGGDGGNGGNAGLIGNGGNGGNAEIVISGGSVAGTGGNGGLLLGFNGTNGL
P